ENJOY MY VIDEO!

Tchaikovsky Violin Concerto in D Major Op.35 Movement 1 and 3 Violinist Phumthana Mu Collaborative Pianist Pingka Sirisujinte Tchaikovsky Violin Concerto in D Major Op.35 Tchaikovsky wrote his Violin Concerto in March 1878 while staying amid the breathtaking mountains of Clarens, Switzerland on Lake Geneva. The work was spurred by a visit from the violinist Iosif Kotek, who had been asking Tchaikovsky for a violin concerto for some time. After playing through Lalo’s Symphonie espagnole together, Tchaikovsky’s imagination was fired with ideas. First movement This gives way to the entrance of the soloist, who introduces the first movement’s main melody, one of Tchaikovsky’s most beautiful themes. The soloist’s music becomes faster and more virtuoso as it unfolds, until we reach a new theme marked “con molto espressione” (with great expression). Though related to the main melody, this theme is warmer, with a faster harmonic rhythm. As it unfolds and develops, the soloist’s music once again becomes increasingly virtuoso, but now with added emotional intensity. The soloist’s runs build to a grand orchestral statement in which the main theme returns in a powerful, heroic guise. This soon disintegrates into fragmentary, unstable music, until the soloist reenters with a delicate variation on the main theme. This builds once again to a heroic, orchestral version of the theme. The music becomes more intense, until it breaks off, leaving the soloist alone. The soloist then plays a cadenza, an extended unaccompanied solo of great difficulty that features some of the violin’s highest notes. After revisiting the main theme and the second theme, the cadenza ends with a trill, the traditional signal for the orchestra to reenter, and the flute begins to play a reprise of the main theme. After a reprise of the second theme, the orchestra and soloist race to the end of the movement in a thrilling coda. Third movement Just as the second movement is about to end, the finale begins with a bang. Parallel to the first movement, an animated orchestral introduction leads to the entrance of the soloist, who then introduces the dancing main theme of the movement. In place of the noble melodies of the previous movements, Tchaikovsky turns now to the earthy sounds of Russian folk music, casting the soloist as a virtuoso Russian fiddler. Impressive passages for the soloist lead to a new theme that appears above a rustic drone bass. Languorous at first, the tune takes on a variety of moods in a series of variations, from fast and brilliant to slow and dreamy. The soloist then accelerates to a reprise of the main theme. After a reprise of the second theme, the main theme then reappears once more, leading to an exhilarating coda. 00:06 1st Movement - Allegro moderato 18:46 3rd Movement - Finale: Allegro vivacissimo Information IG: natural.somu

The Purpose of Life Composed by Phumthana Mu Recorded by Phumthana Mu Mixed and Mastered by Sutthipat Kunakorn Mixed Phumthana Mu Guitar Solo: Supawich Hongsakul Violin: Phumthana Mu Violin: Jirapahn Khaokum Viola: Aekkalux Kheiykhao Flute: Edward James Govier Drummer: Thanapol Anantakrittayathorn Illustration by Bhuree Jiwaluk Information Shouyi Mu Instagram natural.somu ------------------------------------------------------ Bhuree Jiwaluk Facebook Page Dektalk Artwork https://www.facebook.com/DektalkArtwork This piece was written based on my own adventurous experience, and the adventures of others that I have researched in literature, movies, and songs about adventure. The structure of this piece is based on the Hero’s Journey Circle. This piece will give the listener the imagination that the listener is on an adventure along with the piece. I want my audience to feel free and let their imagination take them to places. Listen to the sounds around yourself. This time I'm not gonna divide the section but I want you to follow the sounds and visualize in your own way. The piece includes variations on the melody and harmony of Tchaikovsky Violin Concerto in D Major Op.35 . My aim is to establish a connection between Tchaikovsky's work and his inspiration from the Journey when he composed this piece.

Not long time ago in the PGVIM far away there is The Last Jean-Chamber playing Take 5 but 4 Version Rearrange by Ekkachai James Govit known as Edward James Govier. The Last Jean Chamber Present Take 5 Pea Piano Pin น้อย Germany Exchange Girl Guitar Ploy Oboe Ekkachai James Govit (Edward James Govier) Flute Shouyi Mu Violin Nott Double Bass พี่ Arm Drummer

Mu Violin Mai Flute Pea Piano Mix Bass Omsin Percussion Recording: PGVIM 25/11/2021 Mixing: Mu

Song: กะเหรี่ยงรักสันติภาพ Artist: Deepunu 26/04/2014 ณ ห้วยแก้วมช. Cover By Natural.Somu "We live in the nature We protect the nature" "We used water We protect the river" "We eat food We protect mountain cliff" "We eat fish We protect the fish live" Recording by Phumthana Mu Mixed by Phumthana Mu Illustration by Bhuree Jiwaluk Information Phumthana Mu Instagram natural.somu ------------------------------------------------------ Bhuree Jiwaluk Facebook Page Dektalk Artwork https://www.facebook.com/DektalkArtwork

Saint-Saëns Violin Concerto No.3 in b minor Op.61 Violinist Phumthana Mu Collaborative Pianist Pingka Sirisujinte Saint-Saëns Violin Concerto No.3 in b minor, Op.61 Piece for violin and orchestra written in March 1880. Saint-Saëns dedicated the concerto to fellow composer-virtuoso Pablo de Sarasate, who performed the solo part at the premiere in October 1880 in Hamburg. Even though the third violin concerto seems to impose fewer technical demands on the soloist than its predecessors, its melodic invention and impressionistic subtlety present significant interpretive challenges. This stress is most notable in the second movement and the chorale of the finale, which is reminiscent of the conclusion of the Fourth Piano Concerto. Possibly because of this, the Sarasate concerto along with the Introduction and Rondo Capriccioso, Op. 28, and the Havanaise, Op. 83 have endured as the major concertante works for violin by Saint-Saëns still heard regularly today. Allegro non troppo - The first movement opens immediately with the solo violin, a soft movement with several energetic passages intensity.Unfolds in a straightforward sonata form with a sweetly expressive second theme expressed in delicate triplets. Andantino quasi allegretto -The slow movement opens with the violinist playing a gently rocking barcarolle, while woodwind solos surround it with zephyr breezes. Before the melody has run its course, the winds and solo violin trade roles. Throughout this songlike movement, the music never lifts its voice, finally dying away in delicate accompanimental traceries. Molto moderato e maestoso - Allegro non troppo - The finale opens with a slow introduction derived from a motif in the slow movement. Then, however, it begins a bright staccato tune with hints of Spanish color—a reminder that Saint-Saëns wrote the Concerto while visiting Spain, all the while intending it for Pablo de Sarasate, the greatest Spanish violinist of the century. The second theme is more overtly passionate in expression, though Saint-Saëns reserves this for contrast, along with a hushed melody that follows it sweetly in the strings, against the more assertive “Spanish” tune that dominates with its energy and drive. 00:05 1st Movement: Allegro non troppo 09:45 2nd Movement: Andantino quasi allegretto 18:12 3rd Movement: Molto moderato e maestoso - Allegro non troppo Information Instagram: natural.somu

Wild Pleasure Composed by Phumthana Mu Recording by Phumthana Mu Mixed by Phumthana Mu Illustration by Bhuree Jiwaluk Information Shouyi Mu Instagram natural.somu ------------------------------------------------------ Bhuree Jiwaluk Facebook Page Dektalk Artwork https://www.facebook.com/DektalkArtwork This ten minute piece is based on my own listening experience and reflections. Sometimes, when we travel to different places, we miss the moments we have experienced. So, what do we do ? Some people may go back and look at old pictures, some people sit and immerse themselves in their memories. I would like to present my own memories through sound. The idea behind this composition is to let my listeners experience the beauty of nature through the soundscapes I have created. I want my audience to listen carefully and let their imagination take them to places, visualizing the many different natural sounds heard In this work. The piece is divided into 8 sections which are completely different from each other. Every time we move to a new section, we travel to a new place. The piece includes variations on the melody and harmony of Saint-Saëns Violin Concerto No.3 . My aim is to establish a connection between Saint-Saëns work and his inspiration from the natural world. I look at this composition as a large landscape picture, thinking about the picture and imagining the sounds that exist within that picture and how to express those imaginary places through sound, conveying . my feelings as a traveler who keeps moving to different places . I am someone who likes to travel. I take my inspiration from my travels to natural places. The music that I create is mainly about nature. I was also inspired by Sean Penn’s movie “Into the wild”. It is my favorite movie and is based on a true story. It follows the journey of Christopher McCandles' to Alaska . This evocative film gave me the idea of creating a piece that would be like one person's journey. I use quotes from the movie throughout. I hope you will enjoy this journey. I hope you enjoyed this trip. See you again... Phumthana Mu

Time Mach World Composed by Shouyi Mu Recording by Shouyi Mu Mixed by Shouyi Mu Illustration by Bhuree Jiwaluk Information Shouyi Mu Instagram natural.somu ------------------------------------------------------ Bhuree Jiwaluk Facebook Page Dektalk Artwork https://www.facebook.com/DektalkArtwork In this work, I tried to convey various stories from the past to the present through series of sound pieces. The song was a combination of sound pieces. They were recorded and created, then composed by myself. The work represents the way of life of human beings from the past to present. I used the sound pieces that symbolized each era. By listening, the audiences will get to take a journey back through time from the Middle ages then slowly evolving back to the present. In the Middle Ages, there were many wars, thus you will hear the sound of forging. The sound was intended to represent swordmanship and wars back then. In each period, the listeners would exprience the differences of sound that signified each era. the sound characteristics begin to change - from the sound of sword fights to the sound of gun fights. As from my personal interpretation, human have always been at wars. Human beings are full of greed. That is the reason why human are always fighting for resources. I would like to present this fact in the work. Even after the end of the World War II, human were fighting through economics and technology competitions. As the development of technology leaped forward, the listeners would notice the ever-changing nature of sound- for example The sound of counting money. In the last part, I reduced the image to a smaller size, so that we feel a little closer. The part was intended to present Today’s chaostic situations. Toward the end, I would like to ask the listeners to reflect on what we have done, and what we learned from the past. I hope that this is an opportunity for us to reflect on what would happen in the end, what we all had been through, what we have got, and how happy/ sad we had been. I do not want to spoil this by explaining too much. I would like to invite the listeners to take this adventure together to observe and experience the differences by themselves If you have any ideas or doubt, please share them with us in the comment section. Finally, the world continues to spin and develop. Will peace be restored, or if will there ever be peace?

Program Vladimir Cosma - Le jouet Raymond Scott - Powerhouse In an 18th century drawing room - Raymond Scott Player Violin - Shouyi Mu Flute - Mai Thawatchai Saxophone - Pea Dulayawat Piano - Pea Sanpetch Bass - Dr.Jean-David Caillouët Drum - Omsin Keyboard - Tonlew This is the part of Chamber study.

This is the video from Recital Project Covid 19 lock down Violin Shouyi Mu Flute Mai Piano Pea Drum Omsin Bass Ice

This work is part of my hobby. The Memory of Mattayomgalyanivadhanachalermprakiat. I took these pictures from Leadership Camp in Galyani Vadhana District , Chiang Mai , Thailand. I recorded a song from the children at the Mattayomgalyanivadhanachalermprakiat school. This song name Mattayomgalyanivadhanachalermprakiat School. Compose by Dr.Anothai Nitibhon and Student of Mattayomgalyanivadhanachalermprakiat school. Photo By Shouyi Mu Recording By Shouyi Mu Editing By Shouyi Mu

This work is part of my hobby. The Memory of Mattayomgalyanivadhanachalermprakiat. I took these pictures from Leadership Camp in Galyani Vadhana District , Chiang Mai , Thailand. I recorded a song from the children at the Mattayomgalyanivadhanachalermprakiat school. This song name Galyani Vadhana Chalermprakiet. Compose by Dr.Anothai Nitibhon and Student of Mattayomgalyanivadhanachalermprakiat school. Photo By Shouyi Mu Recording By Shouyi Mu Editing By Shouyi Mu